DPCstruct | MC11904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Standard deviation of domain lengths | 12.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0DRT6 | 1-96 | FADTGAYWRSWYDAPTFEEDLERLYHQLEPLYLHLHAFVRRALHRHYGDRYINLRGPIPAHLLGNMWAQSWDGIYDMVVPFPDKPNL… |
| A0A820LP92 | 1-90 | MSDRSEAMTTAEERRLVEQLWQELKPLYDLVHAYIRQQMAQMYPGHVQLDQPIPLHLTKDLFGTMLTYLEHDIIPFPDIEGIDLGPA… |
| A0A820J814 | 44-142 | None |
| T1H067 | 74-137 | None |
| A0A3P7DYL8 | 318-428 | None |
| A0A653DB62 | 1-97 | None |
| A0A7R9DHN9 | 233-342 | None |
| A0A6H5HBY0 | 404-481 | None |
| A0A821HNE2 | 1-90 | None |
| A0A4Y2J6L1 | 76-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.