DPCstruct | MC11903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 231 ± 31 aa |
| Standard deviation of domain lengths | 31.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K6R1G4 | 13-249 | AHSDDVPVDIMDLALSAHIKILDYSCSQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRHD… |
| A0A820LE79 | 2-223 | AHEDQLHRSMLDHLLYCHLRVFSEGRSSYDALKRNYCLKCMTDLQRNQGWLVSALKHLYELLLHDLTNTFKISEPDLISLLVNKHDI… |
| A0A132AFI7 | 262-540 | None |
| A0A0V0QNV4 | 612-853 | None |
| A0A818CFT4 | 541-800 | None |
| A0A0K2V5N3 | 106-408 | None |
| A0A7J5YVC6 | 595-842 | None |
| M7BUG0 | 869-1137 | None |
| A0A819JKZ3 | 478-739 | None |
| A0A2G8LKV2 | 54-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.