DPCstruct | MC11901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 125 ± 13 aa |
| Standard deviation of domain lengths | 12.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 36.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818WBX3 | 287-412 | RLERALNNRGQYARLGSTGKFYCGGTLDGPQCSCCNGKCGPTSGCNCSSCMLLDVQKRALSRGWLVNRDGASARCSRQETRTFYCGR… |
| A0A820JGA2 | 4-120 | KVNKYGRAATIGVTGKYYCGDYLDVIRCSCCDGRCGPGDGCNCSGCMELDIENRRLPKGTLVNRDGAPASRSRIDGKTFYCGRPVLR… |
| A0A820XA12 | 286-394 | None |
| A0A814ZH65 | 339-440 | None |
| A0A815RTF4 | 57-173 | None |
| A0A812JBS1 | 498-619 | None |
| A0A267E181 | 189-309 | None |
| A0A0M0K621 | 364-499 | None |
| A0A7S2HP66 | 5-124 | None |
| A0A817PWZ9 | 104-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.