DPCstruct | MC1190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 145 ± 22 aa |
| Standard deviation of domain lengths | 21.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7IL40 | 2-127 | EPISSTNIKKYVNLLLKRYQTNQNDRITNPDDPEKWIKSEVDLDEHIRVFADLSTIPSLYPQFLNLGGFKVLSDILSHQNIDVVISC… |
| A0A3S5CKI4 | 6-153 | SGNEPTAFAIANKVEKYNEDLFVEEPSTVGEDSVDEAAVRRLALALEKRTLANQEARTKYADQPKRFMDSEIELQETLEEMQILAAN… |
| A0A0E9NA74 | 57-232 | None |
| K3YPW5 | 6-171 | None |
| A0A1X7SGR9 | 2-140 | None |
| A0A0B6YQV9 | 1-122 | None |
| A0A7R8X0T1 | 373-545 | None |
| A0A7S0DS40 | 36-177 | None |
| H9GU85 | 139-260 | None |
| A0A158Q3E8 | 1185-1361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.