DPCstruct | MC119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 216 ± 26 aa |
| Standard deviation of domain lengths | 25.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13796 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0SPA3 | 96-308 | AGRSTAFIVTGILIQLVELLVLSLPWIFFVPVELWAINLAVLLPLATLVVAAPALTQAQRSRFRARLDVDIPELTGTQPQRGLSGII… |
| A0A1G9YQZ5 | 19-264 | TGDGLSTLVGRFMTAPFRAQTYKNLVYLALQFPLGVTYFTLLVPVLAFGLGTLPLLALFGLPLVGTLVLGIALMTVDRGVTELLLPV… |
| A0A810KXD0 | 7-185 | None |
| A0A6G0X7D4 | 11-260 | None |
| A0A4Q7L8M9 | 10-197 | None |
| A0A117RLL0 | 10-270 | None |
| A0A7X0HLU5 | 1-209 | None |
| D0NE56 | 2-214 | None |
| A0A6B1LBZ2 | 17-232 | None |
| A0A1I0AZJ9 | 1-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.