DPCstruct | MC11899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 140 ± 22 aa |
| Standard deviation of domain lengths | 21.62 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820HVN5 | 38-155 | IERLTHVYKEIFSDEERKRVLETFCRETFEKEEIGESLKPIDSWISMLKRLIVRVLNANVSLTTPLQFYLDRTDLWSGRDSFDDLTK… |
| A0A816Z5P1 | 35-170 | STIYLKYIIDLYELLEEYVFDQVLRNFVKKAWCEESFPVVERTQIVERFIAMTFGKQEIAAPLRNIDSWIGILKRVMIRVLSNVNVD… |
| A0A814D7A6 | 123-239 | None |
| A0A817IJ49 | 97-254 | None |
| A0A821H1D9 | 4-128 | None |
| A0A820YHU9 | 130-297 | None |
| A0A816R0W7 | 59-200 | None |
| A0A820TAV4 | 55-177 | None |
| A0A820DGW4 | 34-199 | None |
| A0A820N8L1 | 158-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.