DPCstruct | MC11897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 501 ± 47 aa |
| Standard deviation of domain lengths | 47.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.40 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0125- PF20209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6BTH3 | 49-590 | NESDVEIVSATDLSYDFKPINTIAKEKLCLIVKIPTKHIHKQITNTIFDMGPPSTTKSITGDGNCLFRAISYALSNRQEFYGNIRKA… |
| A0A820DCQ2 | 186-745 | SDVQNMIAIEVAADGNCLYNSIICLNGNKASAPSELRVRSLIELVKNENFYHNRFAHIVGLVNETIKNIARNFSFSELYEIAALSNV… |
| V4B9J4 | 15-455 | None |
| A0A815Z4X4 | 41-564 | None |
| A0A820DHM5 | 9-411 | None |
| A0A819YY85 | 1-533 | None |
| A0A6J8DB35 | 7-524 | None |
| A0A817V670 | 31-536 | None |
| A0A815VZI3 | 1-506 | None |
| A0A815W3K5 | 559-1064 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.