DPCstruct | MC11895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 269 ± 30 aa |
| Standard deviation of domain lengths | 30.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05781 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5R0Y4 | 1-243 | MSVQPPAMEATPCEYAGILGDSSESDQEPSPEDQLAASWENLPILERLGLSIGTEMTEEEVESAFAQLALAFRCDQYTLAQRLQAEE… |
| A0A663MF53 | 1-246 | MAPSTGEGFAPTVPLCPPPQVPGMDRQELAVRTRESDGTEEDAETPEELLLSLPSELSMLERLGLHRVALTEQDVEAAFAHLALAFR… |
| A0A0B6ZJV7 | 5-284 | None |
| A0A3P8WSI4 | 179-416 | None |
| A0A151NY53 | 267-511 | None |
| A0A672IFA5 | 130-345 | None |
| A0A1S3FXF6 | 63-349 | None |
| A0A4U5USN4 | 1-260 | None |
| A0A6P8ND70 | 48-360 | None |
| A0A1W4XV45 | 5-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.