DPCstruct | MC11890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 126 ± 9 aa |
| Standard deviation of domain lengths | 9.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11580 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4G6C8 | 115-232 | GCVNPSVVVSLKPPLIAVFTDLTTGKKPHHAIKILPQPLRWMKNGIPPVGTRLATVALYEGNLNKGYWDNFHPIVVDCVTGNQADIQ… |
| S0JPB7 | 2-127 | VPGMIVKTEPLTIMAIANMTARDGAATVNGCYCLEVKELDGAQKILFEKIPCSCFFCYEGGDYHSSFQPHPLYWGTADQQSVQEALR… |
| A0A518AGU7 | 166-286 | None |
| B8FIW8 | 236-362 | None |
| A0A1A0K1K7 | 90-216 | None |
| A0A7T8M6C5 | 189-313 | None |
| A0A517XQ52 | 81-201 | None |
| A0A517T3Z5 | 75-190 | None |
| A0A2E2AXR1 | 86-196 | None |
| A0A6N7BY55 | 80-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.