DPCstruct | MC1189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 4.58 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 67.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218VD86 | 203-275 | SGLLVHCISGWDRTPLFISLLRLSLWADGLIHTSLEPSEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNF |
| A0A4Y2RUP7 | 53-138 | EGTSSILIHCISGWDRTPLFVSLLRLSLWADGQIHTSLSPVEMAYLTLAYDWYLFGHDLPSRLKVGEEILFFCFEFLKFITSDDFS |
| A0A094ZMU7 | 146-234 | None |
| A0A6F8ZWC8 | 201-288 | None |
| A0A444SEL8 | 151-239 | None |
| A0A058Z8V8 | 683-766 | None |
| G3PBM9 | 106-192 | None |
| A0A183VWN3 | 1-95 | None |
| A0A452UY81 | 57-143 | None |
| L9KQR5 | 330-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.