DPCstruct | MC11888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 129 ± 12 aa |
| Standard deviation of domain lengths | 12.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P1LL50 | 10-131 | KTSDDKWVIKEEMVTTKAEKWADEFIGRDPRKPELKSAQLRKFYNEVRALADRVEVEGFEKVKPLIKMLKVKVNYQKGRKLVPEKFV… |
| S0J6G0 | 12-136 | LKDGYYRIVDGKECMKPEFIVKYPKEIAKGLKDRNKNKLSQIWKFYEHARRIQDNLEHRGMPFAVSEAELDMMQPIVESALNRSMVT… |
| A0A812ABF1 | 28-175 | None |
| I0EP16 | 33-176 | None |
| A0A7V4V007 | 94-224 | None |
| A0A370JWI8 | 3-157 | None |
| A0A7H8VBB5 | 5-124 | None |
| A0A3M1QLP7 | 26-161 | None |
| A0A2H0FVY0 | 72-195 | None |
| A0A7C3UQW4 | 105-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.