DPCstruct | MC11887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 211 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 84.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18852 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6BX91 | 7-217 | YSMFERDKLDPADSMRIERNIYFEEQTADLSGLTALPLEQLQALREEYAAAEQAAFEALQEQAAAWDEQAGKTLAIDKAIEYVRTPE… |
| A0A1Y3SH69 | 1-213 | MTYHAYDRDELKPASSIRVEHIIYENEQESNVEDLLSAPLQDLVASREKSVEAEREVFIQLKSLAEKWEQQAGVTLLYDKAIEYLKT… |
| A0A1C5XXY8 | 1-214 | None |
| A0A1C6AKA3 | 1-211 | None |
| A0A174JGA7 | 1-214 | None |
| A0A1Y4KKM0 | 7-216 | None |
| A0A1Q9JFF9 | 1-214 | None |
| A0A0E2H0S2 | 7-217 | None |
| A0A564U7Q2 | 1-214 | None |
| A0A1Y4WEH0 | 1-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.