DPCstruct | MC11885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 167 ± 18 aa |
| Standard deviation of domain lengths | 17.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8WRL9 | 11-188 | GPNITSRCGFCDRRMTNWDERTEHIAAHFRAGRTMKDWRGDHEFEPEIAAKVTNAIPPYLIGDETETIVPFSSTSHVVRDHVAQISS… |
| A0A366RDR7 | 359-528 | PISSRCGFCDLRLQSWQDRADHLAQHFRQGKTMAEWKGDHNFEPSIAAQVRNALPPYLLANEALTMVPFSATDPTVPDHFAQIEERN… |
| W2S7T2 | 495-707 | None |
| A0A2N1LM94 | 9-189 | None |
| A0A484FW02 | 878-1056 | None |
| W9ZWA3 | 2-137 | None |
| A0A165INK2 | 513-667 | None |
| A0A1V6THJ1 | 1-138 | None |
| W9YYY4 | 2-140 | None |
| B8N2A2 | 2-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.