DPCstruct | MC11883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 192 ± 22 aa |
| Standard deviation of domain lengths | 21.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T5ABT0 | 2-196 | RACVLLVDGQDGQVIGGGVKFGITSDITTYFIAFAGSDADPWIGFLMQFPIGNDNEDLGLGMIHKLRNDVGEFGGPVPADMYTIEVR… |
| A0A366QUS7 | 1-201 | MATTSSATVTEDCAVFFGHHGPLIASGDKIGLRTKIKAQLRSVQAWDCDTWIGLTLDFPLGKDQKANEEAGFGVRYRAPEHGSQDKS… |
| A0A179HJN8 | 14-216 | None |
| A0A0B4HJ12 | 1-206 | None |
| X0JN36 | 1-181 | None |
| G4UI42 | 2-231 | None |
| A0A2T4BR68 | 3-149 | None |
| A0A2K0UU45 | 1-148 | None |
| A0A3M9YJH4 | 1-220 | None |
| A0A2T4GD43 | 51-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.