DPCstruct | MC11881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 136 ± 17 aa |
| Standard deviation of domain lengths | 17.11 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4A0T0 | 9-134 | LQAQQVQAPVELYSDWLTVGHVDEFMTFIPIPGTKEFRLLMASTSACYKLFREKQKEGHGEAIMFKGLGGMSSKRITINKILSNEKL… |
| A0A366Q9N8 | 15-149 | LKAQEVQDPLILDTSWLYVGHVDEFLQFLPACNERGWILMVADPLKGLDLLRKASKAGHGNVKAVSRSLRVEEKKQELCLPAQTIQE… |
| A0A0F8AWD8 | 201-351 | None |
| A0A1E2Y7L8 | 645-788 | None |
| A0A7Y4P133 | 219-350 | None |
| A0A674HN24 | 774-918 | None |
| F5UGR1 | 683-812 | None |
| A0A811ZSM2 | 281-418 | None |
| N4XHF1 | 267-429 | None |
| A0A4V2EU62 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.