DPCstruct | MC11878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 103 ± 8 aa |
| Standard deviation of domain lengths | 7.81 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067MX73 | 2-106 | IVVNDWCFCKAHGSEYCARCTCDYRLVNNARFEDELDEEARWSFNLDERVPQNAYVAGAIAVAPNSESYKCQRHGSIDCHACFDWVG… |
| A8NHX9 | 54-157 | HIVVNDFMFCAEHGDEYCHACCCDHRLTNNIRIEDELEGVEKFDFELDWEDRQSINVYALGAVADITTEDSFQCEKHETVDCKECFN… |
| A0A5C3KHI4 | 4-113 | None |
| F4S7G3 | 2-104 | None |
| A0A167QYX6 | 14-128 | None |
| A0A5C6SLW0 | 764-856 | None |
| A0A0S2LI04 | 55-158 | None |
| A0A427Y2R2 | 5-113 | None |
| A0A2X0MPV7 | 1-114 | None |
| A0A433QMZ4 | 30-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.