DPCstruct | MC11877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 236 ± 38 aa |
| Standard deviation of domain lengths | 37.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3MI14 | 9-231 | FVPVDPNNPVIQVLDRHNTGHGAFISHLDKHKKMTKFIVFLPVLAINTALATLLIYRFLSGSSVDLIVGIFLGKYIAPSYSTSKSLK… |
| A8NCQ9 | 2-246 | SDGKAGLIQKLQVARDEAIPRILARHCRDSKDGLFIIGPDTSPTSSKRLVFIQACLLNLFIICCVSVLAWTTIFNDFYDTYPAALHA… |
| F0XEH5 | 1-303 | None |
| A0A6A6Q726 | 1-265 | None |
| A0A6A6TV21 | 1-274 | None |
| F8NK25 | 4-214 | None |
| A0A194V2U7 | 12-263 | None |
| A8N940 | 15-194 | None |
| A0A7R7X032 | 131-378 | None |
| A0A4Q2DPX0 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.