DPCstruct | MC11875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 168 ± 26 aa |
| Standard deviation of domain lengths | 26.14 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067U0R0 | 209-371 | SLPYGKSLRTISFKQEDWKLMVEVITACGFDPNTTSVLEMDEADPILECISCNDIRQGRAVQKWSAVMAHKHKTHSGSASKMELALL… |
| A8N534 | 16-207 | VARNARRPQYSIPPEACPSLELNVRASDIASQIIEEARLSPLTATVAQMDALDKRFTCNACLKTETFKQENGHKYKPFLGAYTWRSA… |
| A0A146HPM1 | 827-992 | None |
| A0A0D2P718 | 276-441 | None |
| A0A369JU51 | 2-159 | None |
| A0A369JK21 | 92-221 | None |
| A0A5C3KU74 | 232-402 | None |
| A0A165U9H6 | 28-186 | None |
| B8PKF1 | 293-458 | None |
| A0A4R0RUX4 | 404-566 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.