DPCstruct | MC11874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 64 ± 2 aa |
| Standard deviation of domain lengths | 2.47 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 57.04 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF03799- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T8ANT8 | 1-66 | MAALLGVNIDHVATLRQARGTTYPDPVNAALICEQAGAEGITLHLREDRRHIQDEDVRRMRPVLTT |
| A0A369RJW9 | 1-60 | MKLGVNIDHVATLRNARGTFYPDPLKAATIAIDAGADFITVHLREDRRHIRDEDVFTLKK |
| A0A2B4RLN9 | 41-103 | None |
| A0A5N5T2J5 | 55-116 | None |
| A0A1A9Z148 | 1-67 | None |
| A0A376U3Z7 | 1-65 | None |
| A0A377LX78 | 1-65 | None |
| A0A388Q1U3 | 2-69 | None |
| A0A1B0C1R4 | 345-405 | None |
| D0J1I4 | 266-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.