DPCstruct | MC11873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 5.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0040- CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369RJH2 | 1-93 | MSLTLKQWKEILDTINSNGGDILEAIKEELKKQDQDTYQEWERKDFDINHPFDVQLTMYNKKLALLHIAAYNGHLDIVKYLVDDKKA… |
| A0A5C4TMX9 | 3-91 | FENLKKILSAIDKDASVNKDNVINKIKEVLRREDTIAYQEWENKNFSINHTFIQSDPDAEFTLLIAAAAAGCKDLVNVLLDRHADVH… |
| Q4ED80 | 1-94 | None |
| A0A3D1L510 | 1-98 | None |
| A0A1A9VK22 | 341-434 | None |
| A0A1A9VK06 | 571-663 | None |
| A0A6M5E7Y0 | 1-87 | None |
| A0A060PXG0 | 1-104 | None |
| A0A5C4TN50 | 1-98 | None |
| A0A5E4NQZ0 | 434-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.