DPCstruct | MC11870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 287 ± 68 aa |
| Standard deviation of domain lengths | 67.63 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.89 |
| Pfam Score | 88.91 |
| Assigned Pfam label(s) | CL0010- PF17846 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167R427 | 168-485 | TLEHTAQLGFHHVNVFQGDSRNQSMIINIINRHEGKKTEDLAKQLVGKRVFLNWPFLQEGLCVAVSDEHFKHEEGLIAGRKRIVSKP… |
| A0A0C9SS49 | 1-297 | MVVHISNPYEDLKPQDIAKDLVGKRTFVGWPFLHEAKVVAVSDSLFKYERMAIIPGAAPKIISNPHPPQGVGHWKMKAERIESTYSK… |
| A0A368FT89 | 27-322 | None |
| D3BCJ3 | 151-466 | None |
| A0A7S3E3C3 | 1-189 | None |
| A0A3N4LYQ0 | 1-223 | None |
| Q75JF5 | 653-1020 | None |
| G0QQF0 | 668-1021 | None |
| A0A1R1XHG3 | 314-749 | None |
| A0A7S1FGU1 | 61-439 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.