DPCstruct | MC1187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S5CFV7 | 1-103 | MPVYESQNQPFSTAPAKHSVSPAEERAYVDWINRMLAADTDLQCHLPINWQVDGLLYDRCRDGLLLCKLINFAVPNTIDERCINKPP… |
| G0QS31 | 15-95 | IPVASQEGQSTHSYSSEEVHAFSQHINNSLKDDPHLQSLLPIDSESKQLFDAVGNGIILCKLINKACPGTIFTKAINIEKL |
| A0A822XY42 | 1-77 | None |
| A0A1U7Z7H8 | 73-149 | None |
| A0A3S3MDN2 | 102-190 | None |
| A0A4S4EJ58 | 93-188 | None |
| A0A540M3I9 | 95-189 | None |
| A0A654HZW7 | 379-482 | None |
| A0A2C9K361 | 41-129 | None |
| A0A6D2LGC0 | 104-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.