DPCstruct | MC11868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 12.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9ZAS6 | 184-304 | LTQEQVDFFMENGYIVVKDAFGKEKSDEWTTNMWVRLGLDPSDKSTWDRERIHMPSHKREAVATFAPKAWEIMKELLGGAERIDEDS… |
| A0A2K0TJ05 | 9-134 | LTPEPIEHFMTYGWVSIPSAFTREQAQAWTKDLWTRLGYDENDPSTWVLEKINMPVLNTIDVRDFAPKAWGAICELSGGEKRVAEIS… |
| A0A427YFK6 | 15-143 | None |
| A0A0C9VV38 | 6-108 | None |
| A0A409W279 | 616-735 | None |
| W9XBW8 | 11-135 | None |
| A0A5M3ZBF0 | 921-1045 | None |
| A0A1C6Q8C5 | 16-120 | None |
| A0A084RZ55 | 1-126 | None |
| A0A7J6J249 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.