DPCstruct | MC11867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 166 ± 34 aa |
| Standard deviation of domain lengths | 33.99 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T5AJG5 | 1-193 | MSNAQQLIEDALDDFDALMLEVEQFRFAQQQEVTGGPLLPSACLPHDLLAEIPKEDSTYINLSTTLIPHKCISGLSLLKYQTFHGVA… |
| A0A179FN84 | 3-137 | LLEFRTFAGSMAYQPCCKDIDLMGVFKALRPLEPGGDHLFKVARAWSCIVQSIDGLPKDLRWVLATIYNFSNDMMSSVLSEDTMWTM… |
| A0A0M9EZ77 | 1-116 | None |
| A0A395SE63 | 1-201 | None |
| A0A1B8AU67 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.