DPCstruct | MC11864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 60.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K0TFD3 | 1-78 | MCPNDGCEAMGHLDCWSKRALASDDDPEAILPNSCDCPSCGGHIRWGDMIKELSLRTRGAGEVEKLLKKKRRLAAKES |
| A0A0D2XU90 | 1-57 | MGHLDCWSKHALKGEPKETLLPLSCTCPSCGGKINWSDMMKELTLRVRGPKEVTKLL |
| A0A6M7YZE4 | 711-784 | None |
| M1VV87 | 124-191 | None |
| A0A0G4L0R4 | 376-453 | None |
| T5AAT8 | 158-236 | None |
| A0A2H3GMR6 | 80-150 | None |
| A0A0D9P9D7 | 105-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.