DPCstruct | MC11863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 302 ± 43 aa |
| Standard deviation of domain lengths | 42.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 21.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512MAI5 | 112-429 | HQGPIAINLPNNGGLVHVDPSILPGRIPKGMTQLQMQQALQDKVDDGYRLVSDLTAGNPIGRTCTQKDMTDIMFFLQVKAENSKGSF… |
| A0A2K0TAP6 | 21-280 | EIRTYVAQGAEDVRAIMTSSLSPDELRRIAASQVHPTIRGRLVTGIIWYLTSLAAERNQAFLSGAFLCLDPHGRLSAFFSSIGSLRT… |
| A0A1N6I8G9 | 55-408 | None |
| A0A509E1T0 | 117-506 | None |
| A0A4V1XMA1 | 20-297 | None |
| A0A0U5JFY3 | 222-486 | None |
| A0A2E3LXV3 | 46-346 | None |
| A0A662ZCL8 | 861-1166 | None |
| A0A7Y5M6T3 | 37-376 | None |
| A0A1N6HY91 | 54-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.