DPCstruct | MC11862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 374 ± 35 aa |
| Standard deviation of domain lengths | 34.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366QT48 | 216-598 | QVPNYKKSDLKRCVIPDQPYGPENLHLQDVLPRAGSICFERPQGFVYKAPYMSNMRYPKRLYHDLSMFAEAHSYDKFNATAMLFAVQ… |
| A0A2K0T2L4 | 1-388 | MTFPKDLTRRLEQFALECDKDLLTLDTLYLALFAWYDIVTGHQLNPEECMDGGPNAADSVKIYQPTLAECLVYYPHWLRFTEVTGLA… |
| A0A168KTI5 | 2-343 | None |
| A0A0F7ZHR4 | 283-580 | None |
| G0RCQ8 | 105-493 | None |
| A0A2P4ZSP2 | 271-687 | None |
| A0A1T3CHQ5 | 243-634 | None |
| A0A0I9XBF8 | 139-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.