DPCstruct | MC11859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 241 ± 32 aa |
| Standard deviation of domain lengths | 31.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.58 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF18197- PF07589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T6DN02 | 137-355 | FYYGDSVTVGSGWMRTYVQYNSGAPSRIGIQMSEDAFNAFSSLPGSANMLSLPTQAPAPFNHVMVDWNPEGHPGPGYNAPHFDFHFY… |
| A0A848L7L3 | 2-206 | TGLGVAVTAAALDGLPGGSTATTLMLDLPSGLPAEPFTCVMLNWNPRGHQPTALFGKPHFDIHFDMVTMSDLQAISPSSPGFAAKAA… |
| A0A218Q963 | 17-272 | None |
| A0A3C1UK14 | 1-186 | None |
| A9USY1 | 10-292 | None |
| A0A551Z398 | 6-254 | None |
| A0A448ZBJ0 | 48-322 | None |
| A0A514XNY4 | 7-208 | None |
| A0A1Z4K0K7 | 25-292 | None |
| A0A7W1JPU0 | 87-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.