DPCstruct | MC11856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 169 ± 33 aa |
| Standard deviation of domain lengths | 33.34 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.28 |
| Pfam Score | 99.04 |
| Assigned Pfam label(s) | PF06884- CL0507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9WDW3 | 1-183 | MIQDFTPVKQICAHLNAFHIYANDPTRCVEANHYCTHLTEDVRQCLIYDSPNANARLIGVEYMVSPRIFATLPTEERKLWHTHEFEV… |
| G9ZWF4 | 2-166 | NLYLDGFHFYADDMGRPVEAHHFCTHLTEELHQCTIFDSNTAEARLIGVEYIISERLFSGLADDEKRLWHSHHYETTSGLLVMPGIP… |
| R1GQV9 | 612-814 | None |
| A0A0F7ZFP0 | 16-204 | None |
| A0A7W7M067 | 3-121 | None |
| A0A7X9YT56 | 1-143 | None |
| C1GV76 | 2-126 | None |
| A0A5J5UII2 | 5-184 | None |
| A0A835RAW6 | 21-220 | None |
| A0A3D8T9F1 | 18-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.