DPCstruct | MC11853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 87 ± 5 aa |
| Standard deviation of domain lengths | 5.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6VAP6 | 65-154 | KMVEAMVRMLGRPSLFLTFSAADLHWDSLMQHMPRYEEWKAASSDVRVRIARENLRDNPHIVAFHFHRRLQVFSEEVLRDKFNMVDF… |
| A0A5C6FX93 | 52-138 | QDLEAYAYSLGCPGAFITFSPADLHWRSLYQHMPRYGEWLRASEPERMTLSRHLLRQNPHIAAYHFYRRYCFFRDIVLRKKFNITDY |
| Q2H2C3 | 380-470 | None |
| B8M0X3 | 197-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.