DPCstruct | MC11850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 124 ± 13 aa |
| Standard deviation of domain lengths | 13.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6K520 | 142-254 | ENNHIYYIQRKDTGVDKINSEEEFDIYVVGGNVTIAKNNEEAKDFSEAIEAKYISIDEILKQAEVDSKYGVCRRGFYSDGGTIEYSY… |
| R7NG08 | 33-141 | ALFKIKESDTLETTLYYQDQTNYYLYGLDEVEVTYQNEKKSLKEFLEDGTTIDTLVQDGKNEELSDSIGTLYYVGEANILVCHKNNE… |
| R6BBT0 | 126-231 | None |
| R7L9D0 | 277-395 | None |
| R5MWN1 | 94-217 | None |
| A0A134AAJ7 | 54-176 | None |
| R5HDL2 | 1-131 | None |
| A0A316LGD9 | 1-139 | None |
| A0A847NTA2 | 2-156 | None |
| A0A3D5Z672 | 244-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.