DPCstruct | MC1185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Standard deviation of domain lengths | 3.40 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 56.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S5BYI1 | 1-65 | MLDGIVTDILEARSITYEASSVDIFSASWGPSDDGATIDLPRHYLQRAFIHGAVTVSLRTRSCID |
| T1H0T6 | 59-117 | GVRMLDGDVTDAVEAKSLSLNPQHIDIYSASWGPDDDGKTVDGPGDLATRAFIEGVTKG |
| A0A7E4SDS4 | 203-262 | None |
| A0A1A8A5B2 | 24-80 | None |
| A0A060WP96 | 47-104 | None |
| U4U4V1 | 1-54 | None |
| A0A183KDR8 | 1-58 | None |
| A0A7R9FQI5 | 59-112 | None |
| A0A183R6G9 | 62-112 | None |
| A0A183SNA1 | 59-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.