DPCstruct | MC11849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Standard deviation of domain lengths | 8.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9DMH2 | 1-50 | MSEKSHVLQKVCQYFAYKVRYTNSATEIPEFIIAPEVALELLMAANFLDC |
| A0A673GAE7 | 7-68 | QFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPISPEIALELLMAANFLDC |
| A0A1V8T2S5 | 58-116 | None |
| A0A3N4IKS9 | 40-108 | None |
| A0A1L9PB96 | 2-66 | None |
| A0A6P5NAT6 | 1-73 | None |
| A0A093Y230 | 37-103 | None |
| A0A061SIW1 | 150-225 | None |
| A0A6F9CNF8 | 203-255 | None |
| G0RYE7 | 6-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.