DPCstruct | MC11848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 269 ± 25 aa |
| Standard deviation of domain lengths | 25.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 26.48 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0361- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0J2X3 | 1-271 | MPAANGPKVPLGSLQQQLELLLVCSKCSVKENEITYHPREVEHECMYEILLARRRSRRSAAWRKVSRRPGFPNPARYAVCRYYVMGL… |
| A0A673G7B6 | 13-250 | LESYKLCVRCNKCCKKHNEISYSYKEIIHNCSEDILLIKRKGSNSLWRPVAPLPDFPRPFKYVVCWYFTEESGCTQHGRKCTYARSS… |
| A0A6F9DXI8 | 970-1242 | None |
| A0A673AJV2 | 268-528 | None |
| A0A1I8HRB3 | 1-273 | None |
| A0A6G0HV40 | 137-400 | None |
| A0A7D9NJZ3 | 451-728 | None |
| A0A1I8ILS8 | 434-705 | None |
| A0A1I8IIL8 | 213-484 | None |
| F7G7Y3 | 137-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.