DPCstruct | MC11846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Standard deviation of domain lengths | 8.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04388 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W2HIJ4 | 4-116 | QANIGELLSMLDSPLLSVRDDVTTVFKENLNSDRGPMLVNTLVDYYLETNSQPVLHILTTLQEPHDKHLLDKMNEYVGKAASRLSAL… |
| A0A673FU42 | 1-135 | MAKDQPNVSDLVALLGSTDLHELEQVKNLLQETLSADKGTMLLNSLVEYFLETSSSQAVDILSSVREPHDKYLLDKMNECMGKQSCR… |
| A0A4U5LPB6 | 92-207 | None |
| A0A4W4E6E1 | 1-120 | None |
| A0A2G8LC68 | 1-117 | None |
| A0A1Y1LDE7 | 2-112 | None |
| A0A4V5ZWY8 | 5-113 | None |
| A0A1B0DI92 | 516-635 | None |
| A0A3Q3DPF1 | 1-135 | None |
| A0A3P9AQV6 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.