DPCstruct | MC11845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 169 ± 23 aa |
| Standard deviation of domain lengths | 23.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4LL02 | 17-153 | NQTAASIEGYKQLILKEELARQEWRHQYEASGKEAEQDILDRVRNQPSEILPRSSALQETLRDGISKEGKGRSAFLQARRHENPQTK… |
| A0A673FNH8 | 1-130 | MRNLLTTQDQNFYRELILKEAYTRLAWKMKYSKEYPTTFTREKQPLLTLPPVVQTREKQPLRWSLSEAPLMRAASPQTKAALYRGLS… |
| E4Y8S3 | 117-298 | None |
| A0A3Q1F8X7 | 1-160 | None |
| H3A2R1 | 4-169 | None |
| A0A1B0GRK0 | 1-198 | None |
| A0A834CH36 | 52-229 | None |
| A0A6J3RX41 | 2-141 | None |
| A0A5F5PWZ9 | 23-222 | None |
| A0A3Q7NSQ6 | 50-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.