DPCstruct | MC11841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 263 ± 41 aa |
| Standard deviation of domain lengths | 40.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14800 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q18202 | 121-400 | LEEGTPRIAKSSAISDPKNVNAKVLATVYPDNVICDWLTPPHYDAYSMPSILAIDVPTLTGEDYIATIKALIEDSRFKMFSTIYSRL… |
| A0A6G1SPC9 | 13-267 | ILKLNSTLTQDDYNRALCMLKNDIRFQLHIFLYRRLQTIWILFSSVLCIFLPILLSAHLETIVILGSCLLWLILQAAGLVVGGRCRK… |
| A0A3Q0IYI4 | 139-418 | None |
| A0A0A0UEG1 | 194-484 | None |
| A0A5A9NQY2 | 1-247 | None |
| A0A182KB09 | 85-372 | None |
| V5GPL8 | 1-201 | None |
| A0A7E4SDJ1 | 77-388 | None |
| A0A6P7TVY8 | 432-716 | None |
| A0A2I0TKL9 | 19-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.