DPCstruct | MC11840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 323 ± 50 aa |
| Standard deviation of domain lengths | 49.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.68 |
| Pfam Score | 53.33 |
| Assigned Pfam label(s) | PF12269- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0S3N0 | 1-239 | MIACDNCNQWFHGECIGLSESQGLFVDLFFCENCSKITGKKTSWKPTCANTGCQRPARMGKNFGHLSKYCSDRCGIQVARTRIEQAE… |
| A0A6G1SFG1 | 38-356 | VDKNADWFCPICIKAAKQCGNPPCCIEARPNSKYCSDACGEEYNKERYHRLFLPKWEKLMKQHSKVRIAKMDELDRLDAEQGEVIEL… |
| A0A1D2NA81 | 29-350 | None |
| A0A3Q0J5G3 | 245-511 | None |
| A0A2P8Z829 | 10-444 | None |
| A0A6L5CCD4 | 91-408 | None |
| A0A151I5A6 | 453-760 | None |
| A0A0C3AMH4 | 5-304 | None |
| A0A7J7YDC1 | 2-214 | None |
| A0A1B8EAT7 | 1-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.