DPCstruct | MC1184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452EYD2 | 103-179 | KESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERA |
| A0A3S5BW66 | 1-85 | MSKRVAIELWDWDRTSRNDFMGSLSFGVTELMKTPITYAWYKLLTQEEGEFYAIPCVDEASAAMAELREKIKILRRSESTKNLYK |
| W2SPA9 | 43-130 | None |
| A0A183K928 | 226-321 | None |
| A0A183WM22 | 22-110 | None |
| A0A194Q0Y7 | 146-222 | None |
| A0A444UNP5 | 140-215 | None |
| A0A3Q1BJ72 | 204-279 | None |
| A0A7R8WII0 | 212-283 | None |
| A0A2P4WRA2 | 381-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.