DPCstruct | MC11839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8XXT7 | 4-85 | PSELSIEAIRVFMLENGGKVTNHELVKHFKGFLTDPETRVEARNLFKEYVNTVATIRNEEGEKYLILKKKYRNPAGIQSPVS |
| A0A6G1S571 | 1-84 | MSTMLDINLIRDYLIAVGCRVQYPILVNAFKKYLCHPDPIVQGKVRTKFKDFVNRLATVNVENNMKFITLKLEFRPQHRESSLQ |
| E2C0I4 | 5-87 | None |
| A0A0F8AK45 | 1-84 | None |
| W5MIZ0 | 2-91 | None |
| H3BDP4 | 3-92 | None |
| Q6DIP2 | 3-104 | None |
| A0A0J9RVH9 | 5-112 | None |
| A0A1S3JAI3 | 1-98 | None |
| A0A834MHF1 | 2-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.