DPCstruct | MC11832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 139 ± 20 aa |
| Standard deviation of domain lengths | 19.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A7ARJ2 | 93-235 | VPKATDSELRKDSNPPVEALFNYQLIHIEAYVVYVDMVSQHEVTFKFTPKTIETLIKYHKDIYSVDVSASTWEWAEKEQQLKKLQDR… |
| A0A0J5PF08 | 1-152 | MAPQALDVGLQYQTIHIEAYVVYVDMAYANAVAFKLTPETINTLVKLHRDVYSVCAWLNTWQWSEKENQMRQLQEQFNQDVNRFIFY… |
| A0A2H4S9S5 | 72-217 | None |
| A0A366QWG6 | 100-232 | None |
| D4D2B4 | 229-392 | None |
| A0A1B8A586 | 74-235 | None |
| A0A4P7NVW0 | 3-183 | None |
| A0A4P7NW06 | 320-448 | None |
| A0A135TTN9 | 103-203 | None |
| H0EQI7 | 8-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.