DPCstruct | MC1183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 67 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7TFW3 | 14-71 | PKQDEYGIVLHVSENGKIISSLCDTTGEVIPEAGAVKENNGVLYIGGDILPYIGRYVV |
| A0A3S5BUG9 | 3-58 | GVRKHAMVVRLDPSGRIVESLHDTSGHIFSLSEASEHDGYLYLASYVNQFVARIPL |
| A0A059CUC7 | 178-259 | None |
| A0A158PHJ2 | 595-656 | None |
| A0A0B1SJF9 | 1-58 | None |
| A0A4Z2EEQ4 | 3-59 | None |
| A0A5J5C4Q7 | 123-186 | None |
| A0A815M5W8 | 85-148 | None |
| D7FPD7 | 95-172 | None |
| A0A6V7UUG0 | 21-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.