DPCstruct | MC11827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 161 ± 13 aa |
| Standard deviation of domain lengths | 13.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5L882 | 12-183 | NSTCPTNSLSIKIPVTYALRLVQINWADIMFAIENDYFDIEAAVEYAVHLMELDQSDDLIIELACIKANELIREEIIENYINKFVER… |
| A0A6B0GZD5 | 2-167 | NTLNIKLPYSYIIDYIDLDWHVLLFAVENGFVEKESVLRYAESQIETEANPSQLLLDLAWEKDENSVYEYLIKLANLSSPKDEENLK… |
| A0A1I4RK40 | 13-177 | None |
| A0A1I6HHE6 | 1-159 | None |
| A0A367FTK4 | 33-195 | None |
| A0A3N6CVB6 | 106-272 | None |
| A0A429CUC3 | 249-403 | None |
| A0A0K1QB96 | 2-160 | None |
| A0A833NL34 | 3-133 | None |
| A0A2G5XBV8 | 5-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.