DPCstruct | MC11825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 196 ± 27 aa |
| Standard deviation of domain lengths | 26.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13852 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0XY86 | 342-558 | ELQKQLAFKAMTDVLATSVASALAAAAVLDTWTQPAYAIPVPNAGTFYWLAETVGKVPLVGSKLAGEITNVVDALAVSMKDAALTVA… |
| A0A327R2C8 | 138-355 | TSTSSILGSILSGGSSSVSEKEAGAGIKEALAQGIANGISLLNKKDGFFGSDIYKVLLPADAVKLESTLRKIGLGNEVDKAILQINR… |
| A0A1F3EDJ9 | 10-278 | None |
| A0A4P5YQS7 | 177-378 | None |
| A0A7Y6NK37 | 20-200 | None |
| A0A7S4UZD8 | 11-195 | None |
| A0A848AC00 | 115-293 | None |
| A0A7S3ZKQ2 | 7-233 | None |
| A0A7T2LMD1 | 1-162 | None |
| A0A365VMM0 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.