DPCstruct | MC11823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 111 ± 7 aa |
| Standard deviation of domain lengths | 7.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1D8Q5 | 2-116 | YYQVLVEIKEKIGKSNQNKEITVLDVESRDEVLNDIVIPYLNNEEFVFNGYMLNKREINRLKVMTTEQTVRSLSQYENDNMPQGLIM… |
| A0A327PZK2 | 6-119 | NIYFHVFLSTNNFNGAQEFYELDNPNLEKIKSDIILPFVLKQQFSLQGQVIDPKEVTRIMLRESQLPTAMIMSKVEHDHEPAPWTAQ… |
| A0A2Z3HZ98 | 1-108 | None |
| A0A421B8Z2 | 1-109 | None |
| A0A521TLI6 | 1-100 | None |
| A0A0G0ALQ4 | 161-267 | None |
| A0A832TKJ8 | 5-112 | None |
| A0A0D0JNY3 | 10-121 | None |
| A0A1M5VK85 | 2-108 | None |
| A0A357BS77 | 47-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.