DPCstruct | MC1182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 197 ± 45 aa |
| Standard deviation of domain lengths | 44.70 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 69.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2M8F1 | 46-195 | AKLGAYVGLGIMDAGCRNQTLAFKTLQGHTRMPSIVGFLVFQQFWYWFPLVHFLSLCFVPSCIVLVNPNFEMPKYSFICDADPSFFA… |
| A0A3S5BNL4 | 12-204 | MAKFGAIIACGILDAGGCNMTISLQTRTGNANMVAAVGLLVFQNFWFWYPLTNFLSLAFSPTCIIALNKDLQMPKMQFRSNAKPSTF… |
| A0A813GU74 | 101-261 | None |
| A0A4Y2G851 | 109-254 | None |
| A0A2C5XMY6 | 51-313 | None |
| A0A0N4ZZ07 | 101-328 | None |
| R4XB38 | 669-931 | None |
| A0A540LZW4 | 639-765 | None |
| A0A397F3B7 | 4-210 | None |
| A0A444U653 | 838-1054 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.