DPCstruct | MC11819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 96 ± 17 aa |
| Standard deviation of domain lengths | 17.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9H9V8 | 19-105 | ISPEEEFWVHCSNIHTWSLNSYDTSLLDSYLAFPLLKKLADAGDLIAKRVFKEEISKRLKTNVPQVLRFLLNEKYDLYLTQEELLSS |
| A0A0F9PHB7 | 4-85 | CSNIQAWVENNYNTRILHSNISFPLLKQLVNAGDEMAKKVFGEEVVSRYLKGNATVRVFLNLGGFFNYLKKEQLLFLVTELI |
| A0A0F9L1Z7 | 82-170 | None |
| A0A0F9IL41 | 37-127 | None |
| A0A0F9IV39 | 1-72 | None |
| A0A842QW74 | 84-159 | None |
| A0A0F9QSV9 | 2-72 | None |
| A0A842T7B4 | 70-155 | None |
| A0A0F9GYG6 | 80-159 | None |
| A0A0F9H7G5 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.