DPCstruct | MC11816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 125 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1DRM1 | 32-176 | EIRSEYLVCDAVQMLGLQSFIVTQASLPANAARTLFERLDMRSFPSSLRNRADGPTHTLKTLLALGKVTMNRDTVEIETDTQFFSLK… |
| A0A264T473 | 126-246 | LSYLPIPILKESSPDFWPKPLSFITSSAESKRSNQNPELKYWSDVTPITSFKKNSESSFTYYHIGGYQEVGIIGRGDLNNDEIEDLI… |
| A0A7V8QI88 | 103-220 | None |
| A0A7X4K370 | 29-144 | None |
| A0A7Y3Q7X4 | 1-126 | None |
| A0A3N6WCP4 | 4-135 | None |
| A0A7J0BLG9 | 85-205 | None |
| A0A496BGV9 | 568-695 | None |
| A0A6G6RFQ1 | 179-282 | None |
| A0A241NMQ6 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.