DPCstruct | MC11814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 89 ± 13 aa |
| Standard deviation of domain lengths | 13.02 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1BKI8 | 1-61 | MLTQLEITSRKTVLNGKLYGAVGAYEALCGSAWFALDPNHKQNEAIVDLNLAPVDESGRVI |
| A0A2U1DNR7 | 12-113 | LTAAAAAAITACGGSSNDAPKGPALKLAITATEAFPGTYGDVGEYERVTGTISGEVDPKDPKNAVIQDLALAPTNANGMVEYQADFV… |
| A0A0Q4CP58 | 1-87 | None |
| A0A2V8I6Q9 | 3-76 | None |
| A0A829YC61 | 1-98 | None |
| A0A819X8Z9 | 142-247 | None |
| A0A819XTL7 | 173-285 | None |
| A0A6I6MVQ0 | 2-78 | None |
| A0A814SFG4 | 148-247 | None |
| A0A1Q7HJ73 | 17-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.