DPCstruct | MC11813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 213 ± 41 aa |
| Standard deviation of domain lengths | 40.57 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3MIN1 | 1-130 | MRPLTLHVSALNDAEYELYTSCLNDLIDIHDDPDTVHDDSYYEHISVGVRELRAWLRGRYPELSTADLDSILKFFHANITPGDGLTG… |
| A0A0C3S2J8 | 1-174 | MRPLTLHSSALTDSEYNLYTTALLDLAGEDAVSHPSDDSYYASLVVSAREARAWIRGRYTAGGGALSPGQVDGVLKLFCPALAPADT… |
| A0A060SQK9 | 2-250 | None |
| A0A0H2S2E9 | 4-218 | None |
| M5EA17 | 3-225 | None |
| A0A4S8LFM1 | 2-209 | None |
| A0A0L6VAM0 | 2-202 | None |
| I1BVI6 | 44-332 | None |
| A0A067TG24 | 1-239 | None |
| A0A4Y7PEG9 | 2-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.